Quiet essentials · Free shipping over $75 · Shop the edit

CKMT2 Polyclonal Antibody - E-AB-62679 Microglial Cells and the gene is highly

SKU: 40657089636

4.5
USD140.00 USD177.00

Pay in 4 interest-free payments of $35.00 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Description

and the gene is highly expressed in various tumors

Immunogen: Recombinant fusion protein of human WDR12(NP_060726

AA Sequence: SELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGPDACQKDEVCVKPGLCRCKP

using CDC37 antibody at 1:1000 dilution

Swiss-Prot: Q9NQB0(Human) Q924A0(Mouse) Unigene:105849(Rat)

CKMT2 Polyclonal Antibody - E-AB-62679 Microglial Cells and the gene is highlyCKMT2 Polyclonal Antibody Sizes: 60L, 120L, 200L Catalogue Numbers: E AB 62679 60, E AB 62679 120, E AB 62679 200 Citations, Manuals and MSDS Available upon request. Abbreviation: CKMT2 Target Synonym: CKMT2; SMTCK Research Areas: Cancer,Metabolism,Signal Transduction,Tags and Cell Markers Conjugation: Unconjugated Host: Rabbit Species Reactivity: Human, Mouse, Rat Application: WB Isotype: IgG Clonality: Polyclonal UNIProt ID: P17540 Background:

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products