Pay in 4 interest-free payments of $35.00 Learn more
Ships within 48 hours · Estimated delivery Jul 29 - Aug 3
and the gene is highly expressed in various tumors
Immunogen: Recombinant fusion protein of human WDR12(NP_060726
AA Sequence: SELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGPDACQKDEVCVKPGLCRCKP
using CDC37 antibody at 1:1000 dilution
Swiss-Prot: Q9NQB0(Human) Q924A0(Mouse) Unigene:105849(Rat)
CKMT2 Polyclonal Antibody - E-AB-62679 Microglial Cells and the gene is highlyCKMT2 Polyclonal Antibody Sizes: 60L, 120L, 200L Catalogue Numbers: E AB 62679 60, E AB 62679 120, E AB 62679 200 Citations, Manuals and MSDS Available upon request. Abbreviation: CKMT2 Target Synonym: CKMT2; SMTCK Research Areas: Cancer,Metabolism,Signal Transduction,Tags and Cell Markers Conjugation: Unconjugated Host: Rabbit Species Reactivity: Human, Mouse, Rat Application: WB Isotype: IgG Clonality: Polyclonal UNIProt ID: P17540 Background:
US$ 22.00
US$ 12.00
US$ 22.00
US$ 110.40
US$ 18.00
US$ 22.00